Host taxon 10090
Protein NP_058667.1
interleukin-22 precursor
Mus musculus
Gene Il22, UniProt Q9JJY9
>NP_058667.1|Yersinia pseudotuberculosis IP 32953|interleukin-22 precursor
MAVLQKSMSFSLMGTLAASCLLLIALWAQEANALPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.84 | 4.83819874081365 | 1.5e-8 | 28096329 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)