Bacterial taxon 273123
Protein WP_011192042.1
iron ABC transporter permease
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66CN3
>WP_011192042.1|Yersinia pseudotuberculosis IP 32953|iron ABC transporter permease
MATFLEPLTQGRQFFQQLHLRRGLFTLALIGSLLAAMVIDLATGAANLSPLDVLRLFLVDSSQHDELHQIIFWSIRLPMTLTAVVVGASLGLAGLLMQTVLANPLASPYTLGISAAAGFGAALSIITGFSVGGVLSLGTPLLASLMALLACLPIYFMGQRQGMTPQILVLSGIVVLFFFQSLQSLMLFLASPEAMQQIVFWLFGSLLKANMQGVLMTGSVLACSLVICLQQAWRLTALSAGEEQALGLGINVSALRKLAFLLATLLTAASVSFVGTIGFIGLVAPHFARMLVGEDQRYLIGISALCGSLLLVLASIISKLILPNGVVPIGIIIALIGVPVLFYFVTKQVKRA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.7 | 6.69784863924695 | 8.5e-13 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.03 | 6.03025125207193 | 1.0e-17 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 5.88 | 5.88290057602214 | 1.2e-9 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.06 | 4.05568771579839 | 3.7e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.2 ms
(Link to these results)