Bacterial taxon 273123
Protein WP_011191621.1
iron-sulfur cluster repair protein YtfE
Yersinia pseudotuberculosis IP 32953
Gene ytfE, UniProt Q66F95
>WP_011191621.1|Yersinia pseudotuberculosis IP 32953|iron-sulfur cluster repair protein YtfE
MDYRNQSLGALAIAIPRATKLFRQHQLDFCCGGKQTLLRAANKLNLDIDALEAQLSALQTEPHSSEDWQQQPLTNLISFIISRYHDRHREQLPELVLMAEKVERVHGDKPTCPRGLAAELSAILEELTQHMYKEEQILFPMIQRGMGSQASGPIFVMEAEHDAVGQQLDVVKQLTQNVTPPEGACNTWRALYTGINEFITDLMEHIHLENNLLFPRALRGE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.34 | 4.33651255560786 | 6.9e-24 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.31 | 4.31135690793719 | 2.2e-25 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.96 | 3.96006027622808 | 8.4e-15 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.59 | 2.59089499074087 | 4.0e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 130.6 ms
(Link to these results)