Bacterial taxon 273123
Protein WP_011192548.1
iron/manganese ABC transporter permease subunit YfeC
Yersinia pseudotuberculosis IP 32953
Gene yfeC, UniProt Q669Y3
>WP_011192548.1|Yersinia pseudotuberculosis IP 32953|iron/manganese ABC transporter permease subunit YfeC
MLELLLQPFNYNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGDALSHSVVPGVAGAYALGFPYAAGAFFTGMLAALAMTLVRHITRLREDAIIGFIFSTFFAVGLLIVSLNPTSVNVQSIIFGNILGIADEDVLQVEIIILVSFVILCLIWKDLLAVFFDESHAMSIGLSPLRLKILFFTLLSACTVAALQTVGAILVIAMVVTPGATAYLLTDRFGRLLIIAIAIGAITSAFGAYLSFYLDGATGGVIVTLQTLVFLLAFFFAPKHGLLATRYRTRLKRRHPPVHLPEDNL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.81 | 4.8106884131822 | 5.4e-14 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.37 | 3.3713468665773 | 2.3e-12 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.1 | 3.09506136607723 | 4.0e-17 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.94 | 2.93717126968178 | 1.1e-16 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 49.8 ms
(Link to these results)