Bacterial taxon 273123
Protein WP_002213775.1
IS200/IS605-like element IS1541B family transposase
Yersinia pseudotuberculosis IP 32953
Gene tnp, UniProt Q66ES0
>WP_002213775.1|Yersinia pseudotuberculosis IP 32953|IS200/IS605-like element IS1541B family transposase
MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 7.26 | 7.26470855850933 | 3.8e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 7.02 | 7.02041699936573 | 1.7e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.94 | 6.93728116063725 | 4.1e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.76 | 6.76398443731059 | 2.7e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 163.2 ms
(Link to these results)