Bacterial taxon 273123
Protein WP_002213775.1
IS200/IS605-like element IS1541B family transposase
Yersinia pseudotuberculosis IP 32953
Gene tnp, UniProt Q66ES0
>WP_002213775.1|Yersinia pseudotuberculosis IP 32953|IS200/IS605-like element IS1541B family transposase
MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLCEWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 8.28 | 8.27504071447454 | 3.0e-10 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.11 | 6.10849513570587 | 6.6e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.1 | 6.0974495835807 | 3.2e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.04 | 6.03656395859641 | 9.0e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 20.5 ms
(Link to these results)