Host taxon 10090
Protein NP_065244.2
lymphocyte antigen 6I precursor
Mus musculus
Gene Ly6i, UniProt Q9WU67
>NP_065244.2|Yersinia pseudotuberculosis IP 32953|lymphocyte antigen 6I precursor
MDTSHAIKSCVLILLVTLLCAERAQGLECYQCYGVPFETSCPSFTCPYPDGFCVAQEEEFIANSQRKKVKSRSCHPFCPDEIEKKFILDPNTKMNISCCQEDLCNAAVPTGGSSWTTAGVLLFSLGSVLLQTLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.45 | 4.45133897625025 | 1.3e-12 | 28096329 | |
Retrieved 1 of 1 entries in 12.4 ms
(Link to these results)