Host taxon 10090
Protein NP_081261.1
mast cell-expressed membrane protein 1
Mus musculus
Gene Mcemp1, UniProt Q9D8U6
>NP_081261.1|Yersinia pseudotuberculosis IP 32953|mast cell-expressed membrane protein 1
MHASASQDKNRRKPGHDEGAHNPDYENITLAFRNKDQLKLSQSTPTKQAKFKTSLDPAESPPWLYRTIMMLYVLLALVFLSCIVLSALVLVKNSEMSKELWTLKAELSNVSDTVWNIRELQNQQTRIWEAAQGDIKEVKKTLGTVMSSIQTGNDRLKTVPADITQIKKTLEALEKKAQPQPST
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.41 | 3.40758138300838 | 1.1e-10 | 28096329 | |
Retrieved 1 of 1 entries in 48.6 ms
(Link to these results)