Host taxon 10090
Protein NP_032656.1
metallothionein-2
Mus musculus
Gene Mt2, UniProt P02798
>NP_032656.1|Yersinia pseudotuberculosis IP 32953|metallothionein-2
MDPNCSCASDGSCSCAGACKCKQCKCTSCKKSCCSCCPVGCAKCSQGCICKEASDKCSCCA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.84 | 2.84282645772254 | 6.5e-22 | 28096329 | |
Retrieved 1 of 1 entries in 48.2 ms
(Link to these results)