Bacterial taxon 273123
Protein WP_011191671.1
MoaD/ThiS family protein
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66EY2
>WP_011191671.1|Yersinia pseudotuberculosis IP 32953|MoaD/ThiS family protein
MKFKLSGNLAKFTNYKKELHIDIESSSTLKKLIDNLIEQYPALKEVIYDKELKVKKGYLFSFNGQKINPNEFNEPIKNNDCIDIFTAIAGG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -6.45 | -6.45005774524664 | 2.1e-9 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 1 of 1 entries in 22.3 ms
(Link to these results)