Bacterial taxon 273123
Protein WP_011192158.1
non-heme ferritin
Yersinia pseudotuberculosis IP 32953
Gene ftnA, UniProt Q66BV7
>WP_011192158.1|Yersinia pseudotuberculosis IP 32953|non-heme ferritin
MLKKEMAQKLNEQLNLEFYSANLYLQMSAWCSDKGFEGAAAFLKKHSQEEMQHMERLFEYLSGTGSMPVLGTITAPPVDFVSLADVFKLTYEHEQLITTQINELAHVAMTTHDYSTFNFLQWYVAEQHEEEKLFKSILDKLALVGNSGNSLFFVDKDLKTMAAQGYTSA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.68 | -4.68417422430212 | 1.5e-29 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.57 | -4.57420560011659 | 5.7e-29 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.84 | -1.83780058294737 | 1.4e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.73 | -1.73190598657194 | 0.0014 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.3 ms
(Link to these results)