Host taxon 10090
Protein NP_149028.2
oncomodulin
Mus musculus
Gene Ocm, UniProt P51879
>NP_149028.2|Yersinia pseudotuberculosis IP 32953|oncomodulin
MSITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -5.28 | -5.28376842795782 | 1.3e-6 | 28096329 | |
Retrieved 1 of 1 entries in 11.4 ms
(Link to these results)