Host taxon 10090
Protein NP_444421.2
peptidase inhibitor 15 precursor
Mus musculus
Gene Pi15, UniProt Q8BS03
>NP_444421.2|Yersinia pseudotuberculosis IP 32953|peptidase inhibitor 15 precursor
MQSWRTSPSLKMIMNSAVSLVILLSLLCEAHTVVLLNPTDSSLPANNFTDTEAALSTPLESADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGACTDNLCFPGVTTNYLYWFK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.24 | 4.2392739698461 | 3.9e-26 | 28096329 | |
Retrieved 1 of 2 entries in 26.3 ms
(Link to these results)