Bacterial taxon 273123
Protein WP_011191457.1
periplasmic heavy metal sensor
Yersinia pseudotuberculosis IP 32953
Gene cpxP, UniProt Q66GB1
>WP_011191457.1|Yersinia pseudotuberculosis IP 32953|periplasmic heavy metal sensor
MRKVTTLVMASMFVLGSSAAFAADNTKVTEGYHGDGKMMMNKKGDRGHHNMFDGINLTEQQRQQMRDLMRQSHQSQPRLDLEDHEAMHKLITADKFDEAAVRAQAEKMSQNQIERHVEMAKVRNQMYNLLTPEQKEALNKKHQERIEKLQQKPAAQPSSAQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -5.26 | -5.26481827839098 | 1.1e-39 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.03 | -2.02542518207605 | 5.7e-17 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.44 | -1.44430491263758 | 0.00065 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.05 | -1.05045418364912 | 0.00039 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 79.7 ms
(Link to these results)