Bacterial taxon 273123
Protein WP_011192521.1
phage shock protein PspA
Yersinia pseudotuberculosis IP 32953
Gene pspA, UniProt Q66A62
>WP_011192521.1|Yersinia pseudotuberculosis IP 32953|phage shock protein PspA
MGIFSRFADIVNANINTLLDKAEDPQKLVRLMIQEMEDTLVEIRSTSARALAEKKQLLRRIDHSESQQQEWQEKAELALRKDKEDLARAALLEKQKVMTLVETLKREVATVDETLSRMKHEITELENKLTETRARQQALTLRHQAASSSRDVRRQLDSGKLDEAMARFEQFERRIDHMEAEAETVGVGKQKSLDQQFAELRADDEISSQLAALKAKMKSVE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.97 | 2.96796668042872 | 5.8e-9 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.71 | 2.71130735779952 | 1.6e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.46 | 2.46179202266698 | 4.3e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.24 | 1.2368629232027 | 0.022 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 7.4 ms
(Link to these results)