Host taxon 10090
Protein NP_001170952.1
predicted gene 10104 precursor
Mus musculus
Gene Defa35, UniProt E9QLQ1
>NP_001170952.1|Yersinia pseudotuberculosis IP 32953|predicted gene 10104 precursor
MKTFVLLSALVLLAFQVQADPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHDELSKKLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.36 | -4.36077480508856 | 1.6e-16 | 28096329 | |
Retrieved 1 of 1 entries in 61.5 ms
(Link to these results)