Host taxon 10090
Protein XP_011240405.1
predicted gene 15056 isoform X1
Mus musculus
Gene Gm15056, UniProt E9Q8Z3
>XP_011240405.1|Yersinia pseudotuberculosis IP 32953|predicted gene 15056 isoform X1
MKLLYLLIPVILLISQAMAGCKQERQNEWKDLAQKKGTFINAFINNYEHHYCDSPTTVCLRRKTKCIRMPGFCPGRSFCCMRTMT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.16 | 4.1576695577857 | 1.2e-13 | 28096329 | |
Retrieved 1 of 2 entries in 3 ms
(Link to these results)