Host taxon 10090
Protein NP_001170956.1
predicted gene 15284 precursor
Mus musculus
Gene Defa30, UniProt E9QPZ2
>NP_001170956.1|Yersinia pseudotuberculosis IP 32953|predicted gene 15284 precursor
MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGSSLQEESLRDLVCYCRARGCKGRERMNGTCSKGHLMYMLCCR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.46 | -3.45957765585735 | 0.00053 | 28096329 | |
Retrieved 1 of 1 entries in 72.5 ms
(Link to these results)