Host taxon 10090
Protein NP_001170992.1
predicted gene 15308 precursor
Mus musculus
Gene Defa20, UniProt Q45VN2
>NP_001170992.1|Yersinia pseudotuberculosis IP 32953|predicted gene 15308 precursor
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQPGEEDQAVSVSFGDPEGSALHEKSSRDLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -7.42 | -7.41646965391406 | 3.7e-9 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)