Host taxon 10090
Protein NP_031822.2
protein CTLA-2-alpha isoform a precursor
Mus musculus
Gene Ctla2a, UniProt P12399
>NP_031822.2|Yersinia pseudotuberculosis IP 32953|protein CTLA-2-alpha isoform a precursor
MMVSICEQKLQHFSAVFLLILCLGMMSAAPPPDPSLDNEWKEWKTKFAKAYNLNEERHRRLVWEENKKKIEAHNADYEQGKTSFYMGLNQFSDLTPEEFKTNCYGNSLNRGEMAPDLPEYEDLGKNSYLTPGRAQPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.81 | 2.80858859374258 | 5.5e-22 | 28096329 | |
Retrieved 1 of 1 entries in 102.9 ms
(Link to these results)