Host taxon 10090
Protein NP_033919.1
protein S100-G
Mus musculus
Gene S100g, UniProt P97816
>NP_033919.1|Yersinia pseudotuberculosis IP 32953|protein S100-G
MCAEKSPAEMKSIFQKYAAKEGDPDQLSKEELKLLIQSEFPSLLKASSTLDNLFKELDKNGDGEVSYEEFEAFFKKLSQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.92 | -3.92363346446789 | 4.6e-6 | 28096329 | |
Retrieved 1 of 2 entries in 8.6 ms
(Link to these results)