Host taxon 10090
Protein NP_001158217.1
protein tyrosine phosphatase type IVA 2
Mus musculus
Gene Ptp4a2, UniProt O70274
>NP_001158217.1|Yersinia pseudotuberculosis IP 32953|protein tyrosine phosphatase type IVA 2
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.98 | 2.98339026615862 | 0.032 | 28096329 | |
Retrieved 1 of 1 entries in 17.2 ms
(Link to these results)