Bacterial taxon 273123
Protein WP_002211334.1
pyruvate formate lyase 1-activating protein
Yersinia pseudotuberculosis IP 32953
Gene pflA, UniProt Q66CJ7
>WP_002211334.1|Yersinia pseudotuberculosis IP 32953|pyruvate formate lyase 1-activating protein
MLGRIHSFESCGTVDGPGIRFIVFFQGCLMRCLYCHNRDTWDTHGGKEVTVEELVKEAVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACHKEGIHTCLDTNGFVRRYDPVIDELLDATDLVMLDLKQMDDSIHQNLVGVSNHRTLEFARYLAKRNQKTWIRYVVVPGWSDDDKSAHMLGEFTQNMSNIEKIELLPYHELGKHKWIAMGEEYKLDGVKPPTKEIMDRVKGILEGYGHKVIY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.46 | -3.45881214582895 | 1.6e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.25 | -3.24591487565976 | 6.5e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.09 | -2.09090833788262 | 0.0054 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.01 | -2.01172457252344 | 0.013 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 24.6 ms
(Link to these results)