Host taxon 10090
Protein NP_035397.2
regulator of G-protein signaling 16
Mus musculus
Gene Rgs16, UniProt P97428
>NP_035397.2|Yersinia pseudotuberculosis IP 32953|regulator of G-protein signaling 16
MCRTLATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGISKFEWASKHNKERSFSEDVLGWRESFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSTSAPSGSPAEPSHT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.76 | 3.75947428490155 | 3.2e-10 | 28096329 | |
Retrieved 1 of 2 entries in 38.4 ms
(Link to these results)