Host taxon 10090
Protein NP_076370.3
resistin-like beta precursor
Mus musculus
Gene Retnlb, UniProt Q99P86
>NP_076370.3|Yersinia pseudotuberculosis IP 32953|resistin-like beta precursor
MKPTLCFLFILVSLLPLIVPGNAQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.66 | 3.6562387363327 | 2.7e-10 | 28096329 | |
Retrieved 1 of 2 entries in 46.9 ms
(Link to these results)