Bacterial taxon 273123
Protein WP_002209402.1
ribose 5-phosphate isomerase B
Yersinia pseudotuberculosis IP 32953
Gene rpiB, UniProt Q66EB4
>WP_002209402.1|Yersinia pseudotuberculosis IP 32953|ribose 5-phosphate isomerase B
MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKHERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKTLIEAWLDAEFDGGGSTEKVERIRYYEQSLHD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.2 | 3.20091300749998 | 3.5e-14 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.55 | 2.55202041396291 | 5.0e-12 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.35 | 2.34687017125394 | 2.2e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.87 | -0.872953444895939 | 0.028 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 53.1 ms
(Link to these results)