Host taxon 10090
Protein NP_789804.2
RING finger protein 208
Mus musculus
Gene Rnf208, UniProt Q8K0W3
>NP_789804.2|Yersinia pseudotuberculosis IP 32953|RING finger protein 208
MPADPGPEVGSGWPGLLMSCLKGPHVILKMEAMKIVHPEKFPELPAATPCFPPAPRPTPTLAPKRAWPSDTEIIVNQACGGDMPTLEGASHTPPLPRRPRKGSSELGFPRVAPVDEVIVNQYVIRPGPTASAPSSSGPVIAGEPLECPTCGHTYNVTQRRPRVLSCLHSVCEQCLQILYESCPKYKFISCPTCHRETVLFTDYGLAALAVNTSILSRLPPEALTAPSGGQWGGESEGSCYQTFRQYCGAACTCHVRNPLSACSIM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.4 | -3.39996078900707 | 0.013 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)