Bacterial taxon 273123
Protein WP_002212046.1
SAM-dependent methyltransferase TehB
Yersinia pseudotuberculosis IP 32953
Gene tehB, UniProt Q66B33
>WP_002212046.1|Yersinia pseudotuberculosis IP 32953|SAM-dependent methyltransferase TehB
MENTSAQLAPTLLCYKKLPVWNRDGVPAMFQEKHNTKAGTWAKLTILAGEMDFLILDEAGNTVEKHQFSCEQQPPFIEPQVWHRIATCSDDLQCQLSFYCQPEDFYHKKYNLTPTHSEVIEAVKTVKPGKALDLGCGSGRNSLYLNLLGFDVTAVDKNNDSIGNLQQIIDKEALKGITASSYNINEASLDERYDFILSTVVLMFLQPERIPHIISNMQECTLPGGYNLIISAMSTDDFPCTVPFSFTFQSGELKDYYQDWAILKYNEDVGQLHKTDAQGNRIKLRFATLLAKKIS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.95 | 3.94874396657509 | 5.4e-21 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.88 | 2.87742991064896 | 9.9e-19 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.99 | 1.98503093901268 | 6.2e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.96 | 0.956785119673313 | 0.011 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 26.9 ms
(Link to these results)