Bacterial taxon 273123
Protein WP_002208953.1
septal ring assembly protein ZapB
Yersinia pseudotuberculosis IP 32953
Gene zapB, UniProt Q66G93
>WP_002208953.1|Yersinia pseudotuberculosis IP 32953|septal ring assembly protein ZapB
MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLTQEVQDAAGSREALVRENEQLKQEQHVWQDRLRALLGKMEEV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -5.01 | -5.01375346089665 | 1.2e-28 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.19 | -3.18780957152162 | 3.1e-23 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.91 | -2.91219936393025 | 2.8e-19 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.52 | -2.5164462748458 | 2.6e-9 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 70.8 ms
(Link to these results)