Host taxon 10090
Protein NP_035444.1
serum amyloid A-2 protein preproprotein
Mus musculus
Gene Saa2, UniProt P05367
>NP_035444.1|Yersinia pseudotuberculosis IP 32953|serum amyloid A-2 protein preproprotein
MKLLTSLVFCSLLLGVCHGGFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.85 | 4.85320138539865 | 1.2e-12 | 28096329 | |
Retrieved 1 of 1 entries in 87.3 ms
(Link to these results)