Bacterial taxon 273123
Protein WP_011192112.1
siderophore-iron reductase FhuF
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66C66
>WP_011192112.1|Yersinia pseudotuberculosis IP 32953|siderophore-iron reductase FhuF
MSNTAQLITPSPIGLIADITELFEKTFAHFSRTLKVNADDIPEETMSFHTWSSIDNFPTLIQKYRDEYYGDNDLKPNDKALYSLWSQWYFGLIIPPMMLLLIEYPQTIDTHHKNFKVLFHHSGRPEVVYYQLKWQSQDPGTLLERYYLLLNHHVIPIAEKIESYQGINGRLLWNNIGYLMFWYLGEFKGRLGDDLYQSIINGLFMELSLPNGQDNPLYRTVILRNGTLQRRSCCQRNKLPGVRSCHDCPLEKSPLNLIS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.75 | 4.74648442320033 | 1.1e-10 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.39 | 3.38634919416948 | 2.8e-9 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.16 | 3.15760706530746 | 6.9e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.61 | 1.60526382994557 | 0.0046 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 10.6 ms
(Link to these results)