Host taxon 10090
Protein NP_001093387.1
small integral membrane protein 24 precursor
Mus musculus
Gene Smim24, UniProt Q0VG18
>NP_001093387.1|Yersinia pseudotuberculosis IP 32953|small integral membrane protein 24 precursor
MDTLGRLLLLATLFLTPAEAQQASERRLKPWLVGLAAVVGFLFIVFILMLANRVWCAKGRAEDEEATFRMEHIMNENSQPSKADKKQKKKVDRKGGQSNEALELEEKESSDEERGKKTAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.5 | -3.50139336596082 | 7.2e-94 | 28096329 | |
Retrieved 1 of 1 entries in 72.6 ms
(Link to these results)