Host taxon 10090
Protein NP_001158259.1
small proline-rich protein 2A2
Mus musculus
Gene Sprr2a3, UniProt Q4KL71
>NP_001158259.1|Yersinia pseudotuberculosis IP 32953|small proline-rich protein 2A2
MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.34 | 3.33909962619208 | 9.1e-19 | 28096329 | |
Retrieved 1 of 1 entries in 71.1 ms
(Link to these results)