Host taxon 10090
Protein NP_031529.2
sodium/potassium-transporting ATPase subunit gamma isoform a
Mus musculus
Gene Fxyd2, UniProt Q04646
>NP_031529.2|Yersinia pseudotuberculosis IP 32953|sodium/potassium-transporting ATPase subunit gamma isoform a
MAGEISDLSANSGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.21 | -3.21392966982994 | 0.028 | 28096329 | |
Retrieved 1 of 3 entries in 54.4 ms
(Link to these results)