Host taxon 10090
Protein NP_001076015.1
stefin A-like protein
Mus musculus
Gene Cstdc5, UniProt Q497J0
>NP_001076015.1|Yersinia pseudotuberculosis IP 32953|stefin A-like protein
MSLGGVSEASRATPEIQKIADKVRPQLEAKTNKKYEKFEAVEYKTQAVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTKDDELTYF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 7.2 | 7.19735981312284 | 2.2e-16 | 28096329 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)