Host taxon 10090
Protein NP_001001332.2
stefin A1-like protein
Mus musculus
Gene Cstdc6, UniProt L7N257
>NP_001001332.2|Yersinia pseudotuberculosis IP 32953|stefin A1-like protein
MYGGVSEAKPATPEIQKIADKVRSQLEAKTNKKYEKFEAVEYKTQAVAGENIFIKMDVGHGCFIHIKVFSGPTGKDNYELHGYQTDKAKDDELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.72 | 3.7184458188622 | 0.00023 | 28096329 | |
Retrieved 1 of 1 entries in 3.1 ms
(Link to these results)