Host taxon 10090
Protein NP_776294.1
stefin A2 like 1
Mus musculus
Gene Stfa2l1, UniProt Q8BWM3
>NP_776294.1|Yersinia pseudotuberculosis IP 32953|stefin A2 like 1
MTEYTRKIKGGLSEARPATSEIQEIADKVRLLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMDVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 7.1 | 7.10453623026531 | 4.3e-21 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)