Bacterial taxon 273123
Protein WP_002210725.1
succinate dehydrogenase iron-sulfur subunit
Yersinia pseudotuberculosis IP 32953
Gene sdhB, UniProt Q66DA3
>WP_002210725.1|Yersinia pseudotuberculosis IP 32953|succinate dehydrogenase iron-sulfur subunit
MKLEFSIYRYNPDVDNAPHMQDYTLDAEEGRDMMLLDALIQLKEKDPTLSFRRSCREGVCGSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPYLLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFLIDSRDTETASRLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGHIKSMLLQRSA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.08 | -4.08143785971402 | 8.3e-21 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.7 | -3.69835157844575 | 2.0e-26 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.89 | -2.88918726013155 | 1.8e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.69 | -2.68912599325083 | 2.0e-9 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 35.7 ms
(Link to these results)