Host taxon 10090
Protein NP_001288734.1
transcription factor HES-2
Mus musculus
Gene Hes2, UniProt O54792
>NP_001288734.1|Yersinia pseudotuberculosis IP 32953|transcription factor HES-2
MRLPRRVEDAAELRKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADILEMTVRFLQEQPATLYSSAAPGPLNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQRTVSDDSPSLTLPPAPAPAPSPPVPPPGSSGLWRPW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.35 | -3.35047168646312 | 1.7e-10 | 28096329 | |
Retrieved 1 of 1 entries in 27.1 ms
(Link to these results)