Bacterial taxon 273123
Protein WP_002208796.1
transcriptional regulator
Yersinia pseudotuberculosis IP 32953
Gene psaE, UniProt P68589
>WP_002208796.1|Yersinia pseudotuberculosis IP 32953|transcriptional regulator
MSHCVVLNKLESVLIIGDSRYALSKNEVLLLECLYLRAGDVISHDELLTTCWPDRVVSPTSLPVAIKHIRDVFRKITRSEVIKTYKNEGYSYQKDSVLIIIDDGSTEKESHSAAYTRKEKPDIPIKLVGLQILSHLNSTFFIAIMMVIIIIFFMVGGNDIVSFIDSDTNSVIITNVTTKMNGPTAGLPKVKNSMIFKDDFGLVIICDQSECKQQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.71 | -3.7140146359148 | 4.7e-19 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.34 | 2.34331042732734 | 1.5e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.81 | -1.80698511878983 | 1.0e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.25 | 1.25159782782162 | 0.0067 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 26 ms
(Link to these results)