Bacterial taxon 273123
Protein WP_002210062.1
tRNA dihydrouridine synthase DusB
Yersinia pseudotuberculosis IP 32953
Gene dusB, UniProt Q665E2
>WP_002210062.1|Yersinia pseudotuberculosis IP 32953|tRNA dihydrouridine synthase DusB
MRIGHFQLTNCLIAAPMAGITDRPFRALCHGMGAGMAVSEMLSSNPEVWRTDKSRLRMVHVDEPGIRNVQIAGNDPDEMAAAARINVASGAQIIDINMGCPAKKVNRKLAGSALLQHPDLVKQILSAVVNAVDVPVTLKIRTGWSPEHRNCIEIAQLAENCGIQALTIHGRTRSCLFNGEAEYDSIRAVKQTVSIPVIANGDITDPHKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPMPLGEVQRLLDGHIRELHDFYGPGKGFRIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.3 | -3.30294582674573 | 1.5e-51 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.53 | 1.52557642450248 | 1.4e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.51 | -1.51322840217795 | 0.00014 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.71 | 0.708115854869305 | 0.041 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 25.1 ms
(Link to these results)