Host taxon 10090
Protein NP_077252.2
tumor necrosis factor receptor superfamily member 23 isoform 1 precursor
Mus musculus
Gene Tnfrsf23, UniProt Q9ER63
>NP_077252.2|Yersinia pseudotuberculosis IP 32953|tumor necrosis factor receptor superfamily member 23 isoform 1 precursor
MVTFSHVSSLSHWFLLLLLLNLFLPVIFAMPESYSFNCPDGEYQSNDVCCKTCPSGTFVKAPCKIPHTQGQCEKCHPGTFTGKDNGLHDCELCSTCDKDQNMVADCSATSDRKCECQIGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVCSSSVSNPRNWLFLLMLIVFCI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.81 | 3.81028137137203 | 4.6e-16 | 28096329 | |
Retrieved 1 of 3 entries in 75.2 ms
(Link to these results)