Host taxon 10090
Protein NP_001070977.1
tumor necrosis factor receptor superfamily member 9 isoform 1 precursor
Mus musculus
Gene Tnfrsf9, UniProt P20334
>NP_001070977.1|Yersinia pseudotuberculosis IP 32953|tumor necrosis factor receptor superfamily member 9 isoform 1 precursor
MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.99 | 2.99340988836563 | 0.0033 | 28096329 | |
Retrieved 1 of 3 entries in 29.8 ms
(Link to these results)