Host taxon 10090
Protein NP_031886.3
type I iodothyronine deiodinase
Mus musculus
Gene Dio1, UniProt Q61153
>NP_031886.3|Yersinia pseudotuberculosis IP 32953|type I iodothyronine deiodinase
MGLPQLWLWLKRLVIFLQVALEVAVGKVLMTLFPGRVKQSILAMGQKTGMARNPRFAPDNWVPTFFSIQYFWFVLKVRWQRLEDRAEFGGLAPNCTVVCLSGQKCNIWDFIQGSRPLVLNFGSCTUPSFLLKFDQFKRLVDDFASTADFLIIYIEEAHATDGWAFKNNVDIRQHRSLQERVRAARMLLARSPQCPVVVDTMQNQSSQLYAALPERLYVIQEGRICYKGKAGPWNYNPEEVRAVLEKLCTPPRHVPQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -5.3 | -5.30218770786234 | 1.7e-10 | 28096329 | |
Retrieved 1 of 1 entries in 52.9 ms
(Link to these results)