Bacterial taxon 273123
Protein WP_011191388.1
type III secretion system outer membrane ring subunit SctC
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q663I7
>WP_011191388.1|Yersinia pseudotuberculosis IP 32953|type III secretion system outer membrane ring subunit SctC
MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGESLRDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIFKNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQTAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDATIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSARIEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARGLDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAELKGITYGTMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVARVGHGQSLIIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHLALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQNNKSSYLTQCKMDKSLGWRVVEGACTPAESWCVSAPKRGVL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.14 | 4.14072726057433 | 3.6e-89 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.15 | 3.14815904212756 | 2.8e-147 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 2 | 1.99604022611611 | 3.0e-20 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.12 | 1.123517439428 | 2.5e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 77.3 ms
(Link to these results)