Host taxon 10090
Protein NP_112540.2
urocortin-3 preproprotein
Mus musculus
Gene Ucn3, UniProt Q924A4
>NP_112540.2|Yersinia pseudotuberculosis IP 32953|urocortin-3 preproprotein
MLMPTYFLLPLLLLLGGPRTSLSHKFYNTGPVFSCLNTALSEVKKNKLEDVPLLSKKSFGHLPTQDPSGEEDDNQTHLQIKRTFSGAAGGNGAGSTRYRYQSQAQHKGKLYPDKPKSDRGTKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.34 | -3.33935869553278 | 0.00017 | 28096329 | |
Retrieved 1 of 2 entries in 26.7 ms
(Link to these results)