Bacterial taxon 273123
Protein WP_002210066.1
YhdT family protein
Yersinia pseudotuberculosis IP 32953
Gene yhdT, UniProt Q665E5
>WP_002210066.1|Yersinia pseudotuberculosis IP 32953|YhdT family protein
METRFLQANKEARWAFGLTLAYLAGWIITAYLPGNLPGMSGLPAWFEAACIALPLLFIVLCILMVRLIFRDIPLEDDDAN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.46 | -4.45778079602527 | 4.6e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.55 | -3.55189087744685 | 0.0086 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 2 of 1 entries in 60.5 ms
(Link to these results)