Bacterial taxon 273123
Protein WP_002210965.1
YIP1 family protein
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66A53
>WP_002210965.1|Yersinia pseudotuberculosis IP 32953|YIP1 family protein
MVNHVWGLLTHPRQELQQIKREGESIPHLYTHHVLLLAAIPVICAFIGTTQVGWRFGNGQAIKLDTLTALYSAVIFYTLILAAVALMGQVIYRLARRYASRPSWQRCTLFAGYAATPMFLSGIVALYPLVWLCLFAGIIALCYSAYLMYLGIPTFLDIDRQEGFIFSSSTLAIGVLVLELLLGLTVLLWGYGSRLI
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.6 | -3.59836287555391 | 5.5e-13 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.55 | -3.55002444151872 | 1.0e-12 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.36 | 2.36272041046992 | 0.01 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.94 | 1.93792236758111 | 0.017 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 22.4 ms
(Link to these results)